FREE Shipping Over $99 | Pep Orders over $249 = Free Recon Solution Dismiss
RESEARCH USE ONLY: All products are intended for research use only as defined by the FDA. Not for use in diagnostic procedures, human use, or veterinary use.
| Weight | 0.008125 lbs |
|---|
⚠️ Disclaimer: THIS PRODUCT, SOLD BY LOTI LABS, IS INTENDED AS A RESEARCH CHEMICAL ONLY.
This designation allows the use of this chemical strictly for in-vitro laboratory testing and experimentation. No other uses or purposes are permitted. All information provided on this website is for educational purposes and has been compiled from multiple sources believed to be accurate. Human or animal use of this product is strictly forbidden by law. This product is not a drug, food or cosmetic and may not be misbranded, mislabeled or misused as such. Anyone not adhering to these terms will be blacklisted and forbidden from purchasing.
LL-37 is the only human cathelicidin antimicrobial peptide. For researchers, sourcing high quality LL-37 is crucial for reliable results. When looking where to buy LL-37 for research purposes, purity, molecular integrity and supplier reliability are key to research validity and reproducibility.
This guide covers the molecular characteristics and procurement of LL-37 with a focus on Loti Labs as a supplier for laboratory research needs.
LL-37 has a well defined molecular structure that makes it research relevant. The peptide consists of 37 amino acids in the sequence [LL-37, 37 aa] This starts with the leu gly asp phe motif, followed by phe leu arg asn and continues with phe arg lys ser, ile val gln arg and kys arg ile val.
The full molecular specifications are:
The amphipathic structure of the peptide is important for research applications as it allows interaction with lipid membranes. The sequence segments kys kdy phe leu, val gln arg ile and ile gly lys glu are responsible for this amphipathic nature.
The terminal sequences qln arg ile lys, asp phe leu arg and arg thr glu ser, and the intermediate segments arg ile val gln, arg ile lys asp and arg asn leu val contribute to the peptide’s stability. The leu val pro arg, pro arg thr glu, val pro arg thr and asn leu val pro sequences further enhance its structural integrity for research applications.
Proper handling protocols ensure LL-37 remains molecularly intact throughout research applications. The peptide comes as a lyophilized powder and requires specific storage conditions for optimal stability. Research facilities should store lyophilized LL-37 at -20°C or lower and protect from light and humidity.
Upon reconstitution in aqueous buffers, stability becomes critical for experimental reproducibility. Short-term storage at 4°C may be okay for immediate use, while longer term storage requires -20°C conditions. Avoiding repeated freeze-thaw cycles which can compromise peptide integrity and experimental outcomes.
Lab safety protocols should address LL-37 as a research chemical. Although endogenously expressed in human systems, concentrated peptide preparations require standard lab precautions. Research use only means the substance cannot be used for human or animal administration outside controlled experimental settings.
Stock solution preparation should follow established protocols for peptide research. Many researchers dilute the compound in sterile buffers suitable for their specific experimental requirements. Proper documentation of storage conditions and preparation methods supports experimental reproducibility and regulatory compliance.
When researchers need to buy LL-37 for research, supplier selection matters. Loti Labs offers several advantages for high quality research applications and experimental reliability.
Loti Labs ships same day for orders placed before 1pm EST, Monday through Friday. This fast processing supports time sensitive research projects and minimizes delays in experimental timelines. Orders placed after 1pm EST or on weekends ship the next business day to maintain consistent delivery schedules for research planning.
The company offers 30 day satisfaction guarantee on all products including LL-37 peptide. This policy allows researchers to return unopened products for full refund of the purchase price, reducing procurement risks for lab budgets. Such guarantees show supplier confidence in product quality and supports research planning flexibility.
Quality control is key when buying LL-37 for research. Loti Labs tests every batch with third-party HPLC. HPLC verifies peptide identity and purity and ensures every batch is 95% pure or higher.
Independent testing protocols support research integrity by providing an objective quality assessment. HPLC can detect impurities, degradation products and structural modifications that can affect experimental results. This level of quality control is crucial for reproducible results and regulatory compliance.
The testing documentation is useful for research papers and regulatory submissions. Having purity data supports experimental design and allows you to choose the right concentration for your application.
All products sold by Loti Labs, including LL-37, are research use only. This means use is limited to in vitro laboratory testing and experimentation under controlled research conditions. This does not include human or veterinary use outside approved research protocols.
LL-37 from Loti Labs is not a substance for therapeutic use and may not be misbranded or relabeled for such use. Research facilities must maintain proper documentation and handling protocols in accordance with research chemical regulations. Compliance with these guidelines ensures legal operation and responsible research practices.
The research use only designation reflects regulatory requirements for experimental compounds. Researchers must understand these limitations when designing studies and planning experimental protocols. Proper compliance protects both research institutions and individual investigators from regulatory violations.
Site-specific institutional policies may have additional requirements for research chemical handling and documentation. Researchers should consult with institutional safety committees and regulatory affairs offices to ensure full compliance with applicable regulations. The product information provided by Loti Labs includes necessary regulatory notices and handling guidelines.
Lab personnel involved in LL-37 research should receive training on peptide handling and safety protocols. This includes concentration limits, dilution methods and waste disposal procedures. Research facilities must have appropriate containment and safety equipment for peptide research applications.
When you buy LL-37 from Loti Labs you will receive documentation to support research use compliance. This includes certificates of analysis, safety data sheets and regulatory notices for institutional records. Proper documentation supports audit requirements and regulatory compliance.
The research application scope for LL-37 includes antimicrobial susceptibility testing, cellular interaction studies, membrane research and immune system research. These applications are within the research use parameters and support advancement of scientific knowledge through controlled experimentation. Understanding research use limitations helps investigators design their experimental protocols and stay compliant throughout their research program. Loti Labs supports researchers with regulatory requirements and research applications for LL-37 and related compounds.
$855.99 - $1,069.99
You save
$879.99 - $1,099.99
You save
$804.79 - $1,005.99
You save
$839.99 - $1,049.99
You save
$823.99 - $1,029.99
You save
$831.99 - $1,039.99
You save
$839.99 - $1,049.99
You save
$819.99 - $1,024.99
You save
Support when you need it. Perks when you want them.
Talk to a real person or sign up for early access to new compounds.